SDCBP2 Antibody - N-terminal region : HRP

SDCBP2 Antibody - N-terminal region : HRP
SKU
AVIARP55326_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: SDCBP2 contains 2 PDZ (DHR) domains. The function of SDCBP2 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SDCBP2

Key Reference: Deloukas,P., (2001) Nature 414 (6866), 865-871

Molecular Weight: 23kDa

Peptide Sequence: Synthetic peptide located within the following region: VAPVTGYSLGVRRAEIKPGVREIHLCKDERGKTGLRLRKVDQGLFVQLVQ

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Syntenin-2

Protein Size: 207

Purification: Affinity Purified
More Information
SKU AVIARP55326_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55326_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 27111
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×