SDR39U1 Antibody - middle region : FITC

SDR39U1 Antibody - middle region : FITC
SKU
AVIARP57368_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a member of the short-chain dehydrogenases/reductases (SDR) superfamily, which includes both classical and extended types. The encoded protein represents an extended type, with similarity to epimerases. Alternatively spliced transcript variants that encode different protein isoforms have been described.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human SDR39U1

Molecular Weight: 32kDa

Peptide Sequence: Synthetic peptide located within the following region: KAWVLVTGVAYYQPSLTAEYDEDSPGGDFDFFSNLVTKWEAAARLPGDST

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Epimerase family protein SDR39U1

Protein Size: 293

Purification: Affinity Purified
More Information
SKU AVIARP57368_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57368_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 56948
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×