SEMA3D Antibody - middle region : HRP

SEMA3D Antibody - middle region : HRP
SKU
AVIARP55526_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: SEMA3D induces the collapse and paralysis of neuronal growth cones. SEMA3D could potentially act as repulsive cues toward specific neuronal populations.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SEMA3D

Molecular Weight: 90kDa

Peptide Sequence: Synthetic peptide located within the following region: LECIPKSQQATIKWYIQRSGDEHREELKPDERIIKTEYGLLIRSLQKKDS

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Semaphorin-3D

Protein Size: 777

Purification: Affinity Purified
More Information
SKU AVIARP55526_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55526_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 223117
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×