SERPINA5 Antibody - C-terminal region : Biotin

SERPINA5 Antibody - C-terminal region : Biotin
SKU
AVIARP53555_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: SERPINA5 belongs to the serpin family. It Inhibits activated protein C as well as plasminogen activators.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human SERPINA5

Key Reference: Li,W., (2008) Proc. Natl. Acad. Sci. U.S.A. 105 (12), 4661-4666

Molecular Weight: 45kDa

Peptide Sequence: Synthetic peptide located within the following region: LPSEGKMQQVENGLSEKTLRKWLKMFKKRQLELYLPKFSIEGSYQLEKVL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Plasma serine protease inhibitor

Protein Size: 406

Purification: Affinity Purified
More Information
SKU AVIARP53555_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP53555_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 5104
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×