SERPINA5 Antibody - C-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: SERPINA5 belongs to the serpin family. It Inhibits activated protein C as well as plasminogen activators.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human SERPINA5

Key Reference: Li,W., (2008) Proc. Natl. Acad. Sci. U.S.A. 105 (12), 4661-4666

Molecular Weight: 45kDa

Peptide Sequence: Synthetic peptide located within the following region: VFTSHADLSGISNHSNIQVSEMVHKAVVEVDESGTRAAAATGTIFTFRSA

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Plasma serine protease inhibitor

Protein Size: 406

Purification: Affinity Purified

• SKU: AVIARP53556_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP53556_P050-HRP
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Pig (Porcine), Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 5104
• Host: Rabbit
• Conjugate: Conjugated, HRP