SET Antibody - N-terminal region : HRP

SET Antibody - N-terminal region : HRP
SKU
AVIARP56542_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: SET is a multitasking protein, involved in apoptosis, transcription, nucleosome assembly and histone binding. Isoform 2 anti-apoptotic activity is mediated by inhibition of the GZMA-activated DNase, NME1. In the course of cytotoxic T-lymphocyte (CTL)-indu

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SET

Key Reference: Liu,Z., (2008) Mol. Cell 29 (6), 665-678

Molecular Weight: 32kDa

Peptide Sequence: Synthetic peptide located within the following region: IDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVT

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: cDNA, FLJ96345, Homo sapiens SET translocation (myeloid leukemia-associated) (SET),mRNA EMBL BAG37717.1

Protein Size: 277

Purification: Affinity Purified
More Information
SKU AVIARP56542_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56542_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Immunoprecipitation, Western Blotting, Immunohistochemistry
Human Gene ID 6418
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×