SFRS12IP1 Antibody - N-terminal region : HRP

SFRS12IP1 Antibody - N-terminal region : HRP
SKU
AVIARP55718_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: SFRS12IP1 is a possible splicing regulator involved in the control of cellular survival.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SFRS12IP1

Molecular Weight: 18kDa

Peptide Sequence: Synthetic peptide located within the following region: GYPGHLTFECRNFLRVDPKRDIVLDVSSTSSEDSDEENEELNKLQALQEK

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Protein SREK1IP1

Protein Size: 155

Purification: Affinity Purified
More Information
SKU AVIARP55718_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55718_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 285672
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×