SFXN4 Antibody - C-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: SFXN4 is a multi-pass membrane protein. It belongs to the sideroflexin family. SFXN4 is a potential iron transporter.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human SFXN4

Key Reference: Deloukas,P., (2004) Nature 429 (6990), 375-381

Molecular Weight: 38kDa

Peptide Sequence: Synthetic peptide located within the following region: SCTVLAMGLMVPFSFSIFPQIGQIQYCSLEEKIQSPTEETEIFYHRGV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Sideroflexin-4

Protein Size: 337

Purification: Affinity Purified

• SKU: AVIARP53531_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP53531_P050-FITC
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Pig (Porcine), Rabbit
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 119559
• Host: Rabbit
• Conjugate: Conjugated, FITC