Sgms1 Antibody - middle region : HRP

Sgms1 Antibody - middle region : HRP
SKU
AVIARP55476_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Bidirectional lipid cholinephosphotransferase is capable of converting phosphatidylcholine (PC) and ceramide to sphingomyelin (SM) and diacylglycerol (DAG) and vice versa. Direction is dependent on the relative concentrations of DAG and ceramide as phosphocholine acceptors. Sgms1 directly and specifically recognizes the choline head group on the substrate. It also requires two fatty chains on the choline-P donor molecule in order to be recognized efficiently as a substrate. Sgms1 does not function strictly as a SM synthase and suppresses BAX-mediated apoptosis and also prevents cell death in response to stimuli such as hydrogen peroxide, osmotic stress, elevated temperature and exogenously supplied sphingolipids. Sgms1 may protect against cell death by reversing the stress-inducible increase in levels of proapoptotic ceramide.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Mouse Sgms1

Molecular Weight: 46kDa

Peptide Sequence: Synthetic peptide located within the following region: LTTVMISVVHERVPPKEVQPPLPDTFFDHFNRVQWAFSICEINGMILVGL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Phosphatidylcholine:ceramide cholinephosphotransferase 1

Protein Size: 419

Purification: Affinity Purified
More Information
SKU AVIARP55476_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55476_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 208449
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×