SH3BP4 Antibody - N-terminal region : FITC

SH3BP4 Antibody - N-terminal region : FITC
SKU
AVIARP55075_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a protein with 3 Asn-Pro-Phe (NPF) motifs, an SH3 domain, a PXXP motif, a bipartite nuclear targeting signal, and a tyrosine phosphorylation site. This protein is involved in cargo-specific control of clathrin-mediated endocytosis, specifically controlling the internalization of a specific protein receptor.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SH3BP4

Molecular Weight: 107kDa

Peptide Sequence: Synthetic peptide located within the following region: FTTLKFSKGDHLYVLDTSGGEWWYAHNTTEMGYIPSSYVQPLNYRNSTLS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: SH3 domain-binding protein 4

Protein Size: 963

Purification: Affinity Purified
More Information
SKU AVIARP55075_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55075_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 23677
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×