SH3BP4 Antibody - N-terminal region : HRP

SH3BP4 Antibody - N-terminal region : HRP
SKU
AVIARP55076_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes a protein with 3 Asn-Pro-Phe (NPF) motifs, an SH3 domain, a PXXP motif, a bipartite nuclear targeting signal, and a tyrosine phosphorylation site. This protein is involved in cargo-specific control of clathrin-mediated endocytosis, specifically controlling the internalization of a specific protein receptor.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human SH3BP4

Molecular Weight: 60kDa

Peptide Sequence: Synthetic peptide located within the following region: PSSYVQPLNYRNSTLSDSGMIDNLPDSPDEVAKELELLGGWTDDKKVPGR

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: SH3 domain-binding protein 4

Protein Size: 552

Purification: Affinity Purified
More Information
SKU AVIARP55076_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55076_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 23677
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×