SH3GL1 Antibody - N-terminal region : FITC

SH3GL1 Antibody - N-terminal region : FITC
SKU
AVIARP56547_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: SH3GL1 is implicated in endocytosis. It may recruit other proteins to membranes with high curvature.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SH3GL1

Key Reference: Ralser,M., (2005) Hum. Mol. Genet. 14 (19), 2893-2909

Molecular Weight: 41kDa

Peptide Sequence: Synthetic peptide located within the following region: LNTVSKIRGQVKNPGYPQSEGLLGECMIRHGKELGGESNFGDALLDAGES

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Endophilin-A2

Protein Size: 368

Purification: Affinity Purified
More Information
SKU AVIARP56547_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56547_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 6455
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×