SLC25A31 Antibody - N-terminal region : FITC

SLC25A31 Antibody - N-terminal region : FITC
SKU
AVIARP53805_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Mitochondrial ADP/ATP carriers, such as SLC25A31, are nuclear-coded mitochondrial proteins that catalyze the exchange of ATP generated in mitochondria by ATP synthase (see MIM 108729) against ADP produced in cytosol by most energy-consuming reactions.Mitochondrial ADP/ATP carriers, such as SLC25A31, are nuclear-coded mitochondrial proteins that catalyze the exchange of ATP generated in mitochondria by ATP synthase (see MIM 108729) against ADP produced in cytosol by most energy-consuming reactions (Dolce et al., 2005 [PubMed 15670820]).[supplied by OMIM].

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SLC25A31

Key Reference: Kim,Y.H., (2007) Dev. Biol. 302 (2), 463-476

Molecular Weight: 35kDa

Peptide Sequence: Synthetic peptide located within the following region: LAGGVAAAVSKTAVAPIERVKLLLQVQASSKQISPEARYKGMVDCLVRIP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: ADP/ATP translocase 4

Protein Size: 315

Purification: Affinity Purified
More Information
SKU AVIARP53805_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP53805_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 83447
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×