SMARCA2, His-tag Recombinant

SMARCA2, His-tag Recombinant
SKU
BPS31111
Packaging Unit
100 µg
Manufacturer
BPS Bioscience

Availability: loading...
Price is loading...
Products from BPS Bioscience require a minimum order value above 400€

Encompassing Amino Acids: 1375-1511

Amino Acid Sequence: MHHHHHHKLSPNPPKLTKQMNAIIDTVINYKDRCNVEKVPSNSQLEIEGNSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLGDLEKDVMLLCHNAQTFNLEGSQIYEDSIVLQSVFKSARQKIAKEEE

Application: Useful for the study of bromodomain binding assays, screening inhibitors, and selectivity profiling.

Description: Human Bromodomain SMARCA2, also known as BRM, GenBank Accession No. NM_003070, a.a. 1375 - 1511 corresponding to single bromodomain with N-terminal His-tag, MW = 16.9 kDa, expressed in an E. coli expression system.

Format: Aqueous buffer solution

Formulation: 40 mM Tris-HCl, pH 8.0, 110 mM NaCl, 2.2 mM KCl, 0.04 % Tween-20, 20% glycerol

Genbank: NM_003070

Storage Stability: At least 6 months at -80°C.

Tags: N-terminal His-tag

Uniprot: P51531

Warnings: Avoid freeze/thaw cycles.

Biosafety Level: Not applicable (BSL-1)

References: 1. Shain, A.H., et al., Proc Natl Acad Sci USA. 2012 Jan 31; 109(5): E252-9.
2. Liu, G., et al., Oncogene. 2011 Jul 21; 30(29): 3295-304
More Information
SKU BPS31111
Manufacturer BPS Bioscience
Manufacturer SKU 31111
Package Unit 100 µg
Quantity Unit STK
Product information (PDF) Download
MSDS (PDF)
×