SMG5 Antibody - N-terminal region : Biotin

SMG5 Antibody - N-terminal region : Biotin
SKU
AVIARP55229_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: SMG5 plays a role in nonsense-mediated mRNA decay. SMG5 does not have RNase activity by itself. SMG5 promotes dephosphorylation of RENT1. SMG5 is necessary for TERT activity.SMG5 is involved in nonsense-mediated mRNA decay (Ohnishi et al., 2003 [PubMed 14636577]).[supplied by OMIM].

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SMG5

Key Reference: Glavan,F., (2006) EMBO J. 25 (21), 5117-5125

Molecular Weight: 114kDa

Peptide Sequence: Synthetic peptide located within the following region: MSQGPPTGESSEPEAKVLHTKRLYRAVVEAVHRLDLILCNKTAYQEVFKP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein SMG5

Protein Size: 1016

Purification: Affinity Purified
More Information
SKU AVIARP55229_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55229_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 23381
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×