SNAPC5 Antibody - N-terminal region : Biotin

SNAPC5 Antibody - N-terminal region : Biotin
SKU
AVIARP57932_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: SNAPC5 is the part of the SNAPc complex required for the transcription of both RNA polymerase II and III small-nuclear RNA genes. SNAPC5 binds to the proximal sequence element (PSE), a non-TATA-box basal promoter element common to these 2 types of genes. Recruits TBP and BRF2 to the U6 snRNA TATA box.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SNAPC5

Molecular Weight: 11kDa

Peptide Sequence: Synthetic peptide located within the following region: KEEETLLRLKAALHDQLNRLKVEELALQSMISSRRGDEMLSSHTVPEQSH

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: snRNA-activating protein complex subunit 5

Protein Size: 98

Purification: Affinity Purified

Subunit: 5
More Information
SKU AVIARP57932_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57932_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 10302
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×