SND1-IT1 Antibody - N-terminal region : Biotin

SND1-IT1 Antibody - N-terminal region : Biotin
SKU
AVIARP55045_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human SNIT1

Key Reference: N/A

Molecular Weight: 12kDa

Peptide Sequence: Synthetic peptide located within the following region: LRNSCLIRMDLLYWQFTIYTITFCFSHLSGRLTLSAQHISHRPCLLSYSL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Size: 110

Purification: Affinity purified
More Information
SKU AVIARP55045_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55045_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Western Blotting
Human Gene ID 27099
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×