SNRK Antibody - middle region : FITC

SNRK Antibody - middle region : FITC
SKU
AVIARP56306_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: SNRK may play a role in hematopoietic cell proliferation or differentiation. SNRK is the potential mediator of neuronal apoptosis.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SNRK

Key Reference: Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)

Molecular Weight: 84kDa

Peptide Sequence: Synthetic peptide located within the following region: SSSETSDDDSESRRRLDKDSGFTYSWHRRDSSEGPPGSEGDGGGQSKPSN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: SNF-related serine/threonine-protein kinase

Protein Size: 765

Purification: Affinity Purified
More Information
SKU AVIARP56306_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56306_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 54861
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×