SNRK Antibody - middle region : HRP

SNRK Antibody - middle region : HRP
SKU
AVIARP56306_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: SNRK may play a role in hematopoietic cell proliferation or differentiation. SNRK is the potential mediator of neuronal apoptosis.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SNRK

Key Reference: Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)

Molecular Weight: 84kDa

Peptide Sequence: Synthetic peptide located within the following region: SSSETSDDDSESRRRLDKDSGFTYSWHRRDSSEGPPGSEGDGGGQSKPSN

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: SNF-related serine/threonine-protein kinase

Protein Size: 765

Purification: Affinity Purified
More Information
SKU AVIARP56306_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56306_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 54861
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×