SNTG1 Antibody - middle region : Biotin

SNTG1 Antibody - middle region : Biotin
SKU
AVIARP57300_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The protein encoded by this gene is a member of the syntrophin family. Syntrophins are cytoplasmic peripheral membrane proteins that typically contain 2 pleckstrin homology (PH) domains, a PDZ domain that bisects the first PH domain, and a C-terminal doma

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SNTG1

Molecular Weight: 58kDa

Peptide Sequence: Synthetic peptide located within the following region: RFSQYVPGTDLSRQNAFQVIAVDGVCTGIIQCLSAEDCVDWLQAIATNIS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Gamma-1-syntrophin

Protein Size: 517

Purification: Affinity Purified
More Information
SKU AVIARP57300_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57300_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 54212
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×