SNTG1 Antibody - middle region : HRP

SNTG1 Antibody - middle region : HRP
SKU
AVIARP57300_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The protein encoded by this gene is a member of the syntrophin family. Syntrophins are cytoplasmic peripheral membrane proteins that typically contain 2 pleckstrin homology (PH) domains, a PDZ domain that bisects the first PH domain, and a C-terminal doma

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SNTG1

Molecular Weight: 58kDa

Peptide Sequence: Synthetic peptide located within the following region: RFSQYVPGTDLSRQNAFQVIAVDGVCTGIIQCLSAEDCVDWLQAIATNIS

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Gamma-1-syntrophin

Protein Size: 517

Purification: Affinity Purified
More Information
SKU AVIARP57300_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57300_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 54212
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×