SOX13 Antibody - middle region : FITC

SOX13 Antibody - middle region : FITC
SKU
AVIARP58143_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: SOX13 is a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. It has also been determined to be a type-1 diabetes autoantigen, also known as islet cell antibody 12. This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. It has also been determined to be a type-1 diabetes autoantigen, also known as islet cell antibody 12. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SOX13

Key Reference: Park,Y., Ann. N. Y. Acad. Sci. 1005, 253-258 (2003)

Molecular Weight: 69kDa

Peptide Sequence: Synthetic peptide located within the following region: TARYCGSFCQHKDWEKHHHICGQTLQAQQQGDTPAVSSSVTPNSGAGSPM

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Transcription factor SOX-13

Protein Size: 622

Purification: Affinity Purified
More Information
SKU AVIARP58143_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58143_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 9580
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×