SPAG11B Antibody - N-terminal region : Biotin

SPAG11B Antibody - N-terminal region : Biotin
SKU
AVIARP53717_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: SPAG11B is one of several androgen-dependent, epididymis-specific secretory proteins. The specific functions of these proteins have not been determined, but they are thought to be involved in sperm maturation. Some of the isoforms contain regions of similarity to beta-defensins, a family of antimicrobial peptides.This gene encodes several androgen-dependent, epididymis-specific secretory proteins. The specific functions of these proteins have not been determined, but they are thought to be involved in sperm maturation. Some of the isoforms contain regions of similarity to beta-defensins, a family of antimicrobial peptides. The gene is located on chromosome 8p23 near the defensin gene cluster. Alternative splicing of this gene results in seven transcript variants encoding different isoforms. Two different N-terminal and five different C-terminal protein sequences are encoded by the splice variants. Two additional variants have been described, but their full length sequences have not been determined.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SPAG11B

Key Reference: Avellar,M.C., (2004) Biol. Reprod. 71 (5), 1453-1460

Molecular Weight: 15kDa

Peptide Sequence: Synthetic peptide located within the following region: MRQRLLPSVTSLLLVALLFPGSSQARHVNHSATEALGELRERAPGQGTNG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Sperm-associated antigen 11B

Protein Size: 133

Purification: Affinity Purified
More Information
SKU AVIARP53717_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP53717_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Western Blotting
Human Gene ID 10407
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×