SPAG11B Antibody - N-terminal region : HRP

SPAG11B Antibody - N-terminal region : HRP
SKU
AVIARP53717_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: SPAG11B is one of several androgen-dependent, epididymis-specific secretory proteins. The specific functions of these proteins have not been determined, but they are thought to be involved in sperm maturation. Some of the isoforms contain regions of similarity to beta-defensins, a family of antimicrobial peptides.This gene encodes several androgen-dependent, epididymis-specific secretory proteins. The specific functions of these proteins have not been determined, but they are thought to be involved in sperm maturation. Some of the isoforms contain regions of similarity to beta-defensins, a family of antimicrobial peptides. The gene is located on chromosome 8p23 near the defensin gene cluster. Alternative splicing of this gene results in seven transcript variants encoding different isoforms. Two different N-terminal and five different C-terminal protein sequences are encoded by the splice variants. Two additional variants have been described, but their full length sequences have not been determined.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SPAG11B

Key Reference: Avellar,M.C., (2004) Biol. Reprod. 71 (5), 1453-1460

Molecular Weight: 15kDa

Peptide Sequence: Synthetic peptide located within the following region: MRQRLLPSVTSLLLVALLFPGSSQARHVNHSATEALGELRERAPGQGTNG

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Sperm-associated antigen 11B

Protein Size: 133

Purification: Affinity Purified
More Information
SKU AVIARP53717_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP53717_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Western Blotting
Human Gene ID 10407
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×