Spata6 Antibody - C-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Spata6 may function as a molecular motor in meiosis and have a role in spermatogenesis.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Spata6

Molecular Weight: 47kDa

Peptide Sequence: Synthetic peptide located within the following region: RVKDVLKSHQAHGRHLCEERDPEKEDELELKRSLLYRDSAYDSDPEYSSF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Spermatogenesis-associated protein 6

Protein Size: 430

Purification: Affinity Purified

• SKU: AVIARP53737_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP53737_P050-FITC
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 171413
• Host: Rabbit
• Conjugate: Conjugated, FITC