SPATA6 Antibody - middle region : FITC

SPATA6 Antibody - middle region : FITC
SKU
AVIARP53736_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: SPATA6 belongs to the SPATA6 family. SPATA6 may play a role in spermatid maturation or sperm function.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SPATA6

Key Reference: Gregory,S.G., (2006) Nature 441 (7091), 315-321

Molecular Weight: 54kDa

Peptide Sequence: Synthetic peptide located within the following region: SQKKKSKSPERSKYCINAKNYEQPTISSKSHSPSPYTKRRMCELSEDTRR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Spermatogenesis-associated protein 6

Protein Size: 488

Purification: Affinity Purified
More Information
SKU AVIARP53736_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP53736_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 54558
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×