SSX2IP Antibody - middle region : FITC

SSX2IP Antibody - middle region : FITC
SKU
AVIARP53690_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: SSX2IP belongs to an adhesion system, which plays a role in the organization of homotypic, interneuronal and heterotypic cell-cell adherens junctions (AJs). It may connect the nectin-afadin and E-cadherin-catenin system through alpha-actinin and may be involved in organization of the actin cytoskeleton at AJs through afadin and alpha-actinin.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SSX2IP

Key Reference: Guinn,B.A., (2008) Br. J. Haematol. 140 (2), 250-251

Molecular Weight: 68kDa

Peptide Sequence: Synthetic peptide located within the following region: KVHLEGFNDEDVISRQDHEQETEKLELEIQQCKEMIKTQQQLLQQQLATA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Afadin- and alpha-actinin-binding protein

Protein Size: 614

Purification: Affinity Purified
More Information
SKU AVIARP53690_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP53690_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting, Immunohistochemistry
Human Gene ID 117178
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×