STAMBP Antibody - C-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: STAMBPL1 is a zinc metalloprotease that specifically cleaves 'Lys-63'-linked polyubiquitin chains.STAMBPL1 does not cleave 'Lys-48'-linked polyubiquitin chains.

Molecular Weight: 48kDa

Peptide Sequence: Synthetic peptide located within the following region: QETGFFKLTDHGLEEISSCRQKGFHPHSKDPPLFCSCSHVTVVDRAVTIT

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: STAM-binding protein

Protein Size: 424

Purification: Affinity Purified

• SKU: AVIARP53527_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP53527_P050-HRP
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 10617
• Host: Rabbit
• Conjugate: Conjugated, HRP