Stxbp6 Antibody - N-terminal region : HRP

Stxbp6 Antibody - N-terminal region : HRP
SKU
AVIARP54989_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Stxbp6 forms non-fusogenic complexes with SNAP25 and STX1A and may thereby modulate the formation of functional SNARE complexes and exocytosis.

Molecular Weight: 23kDa

Peptide Sequence: Synthetic peptide located within the following region: SAISKEIFAPLDERMLGAIQVKRRTKKKIPFLATGGQGEYLTYICLSVTN

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Syntaxin-binding protein 6

Protein Size: 210

Purification: Affinity Purified
More Information
SKU AVIARP54989_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54989_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 217517
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×