TBC1D14 Antibody - N-terminal region : Biotin

TBC1D14 Antibody - N-terminal region : Biotin
SKU
AVIARP56315_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: TBC1D14 may act as a GTPase-activating protein for Rab family protein(s).

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TBC1D14

Key Reference: Tempel,W., (2008) Proteins 71 (1), 497-502

Molecular Weight: 76kDa

Peptide Sequence: Synthetic peptide located within the following region: MTDGKLSTSTNGVAFMGILDGRPGNPLQNLQHVNLKAPRLLSAPEYGPKL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: TBC1 domain family member 14

Protein Size: 693

Purification: Affinity Purified
More Information
SKU AVIARP56315_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56315_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 57533
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×