TBC1D22A Antibody - middle region : FITC

TBC1D22A Antibody - middle region : FITC
SKU
AVIARP55030_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: TBC1D22A contains 1 Rab-GAP TBC domain. It may act as a GTPase-activating protein for Rab family protein(s).

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of TBC1D22A

Molecular Weight: 59kDa

Peptide Sequence: Synthetic peptide located within the following region: MTWKLLSGYLPANVDRRPATLQRKQKEYFAFIEHYYDSRNDEVHQDTYRQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: TBC1 domain family member 22A

Protein Size: 517

Purification: Affinity Purified
More Information
SKU AVIARP55030_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55030_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 25771
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×