TBC1D7 Antibody - middle region : Biotin

TBC1D7 Antibody - middle region : Biotin
SKU
AVIARP56926_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: TBC1D7 belongs to a family of proteins sharing a 180- to 200-amino acid TBC domain presumed to have a role in regulating cell growth and differentiation. These proteins share significant homology with TRE2, yeast Bub2, and CDC16.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human TBC1D7

Molecular Weight: 27kDa

Peptide Sequence: Synthetic peptide located within the following region: MYQLESGKLPRSPSFPLPKAFEQYLNLEDGRLLTHLRMCSAAPKLPYDLW

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: TBC1 domain family member 7

Protein Size: 247

Purification: Affinity Purified
More Information
SKU AVIARP56926_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56926_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Goat (Caprine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 51256
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×