TCP11 Antibody - middle region : Biotin

TCP11 Antibody - middle region : Biotin
SKU
AVIARP53731_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: TCP11 may play an important role in sperm function and fertility.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TCP11

Key Reference: Ma,Y.X., (2003) Zhongguo Yi Xue Ke Xue Yuan Xue Bao 25 (2), 122-128

Molecular Weight: 49kDa

Peptide Sequence: Synthetic peptide located within the following region: DMVNYTIQSLQPHLQEHSIQYERAKFQELLNKQPSLLNHTTKWLTQAAGD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: T-complex protein 11 homolog

Protein Size: 441

Purification: Affinity Purified
More Information
SKU AVIARP53731_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP53731_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 6954
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×