TCP11L1 Antibody - C-terminal region : Biotin

TCP11L1 Antibody - C-terminal region : Biotin
SKU
AVIARP57234_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human TCP11L1

Molecular Weight: 65kDa

Peptide Sequence: Synthetic peptide located within the following region: GQIQAVASPDDPIRRIMESRILTFLETYLASGHQKPLPTVPGGLSPVQRE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: T-complex protein 11-like protein 1

Protein Size: 595

Purification: Affinity Purified
More Information
SKU AVIARP57234_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57234_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 55346
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×