TEAD4 Recombinant Protein

TEAD4 Recombinant Protein
SKU
AVIOPCA335976-100
Packaging Unit
100µg
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Description of Target: Transcription factor which plays a key role in the Hippo signaling pathway, a pathway involved in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. The core of this pathway is composed of a kinase cascade wherein MST1/MST2, in complex with its regulatory protein SAV1, phosphorylates and activates LATS1/2 in complex with its regulatory protein MOB1, which in turn phosphorylates and inactivates YAP1 oncoprotein and WWTR1/TAZ. Acts by mediating gene expression of YAP1 and WWTR1/TAZ, thereby regulating cell proliferation, migration and epithelial mesenchymal transition (EMT) induction. Binds specifically and non-cooperatively to the Sph and GT-IIC 'enhansons' (5'-GTGGAATGT-3') and activates transcription. Binds to the M-CAT motif.

Key Reference: A novel family of developmentally regulated mammalian transcription factors containing the TEA/ATTS DNA binding domain. Jacquemin P., Hwang J.-J., Martial J.A., Dolle P., Davidson I. J. Biol. Chem. 271:21775-21785(1996).

Molecular Weight: 67.3 kDa.

Product Format: Liquid or Lyophilized powder.

Protein Name: transcriptional enhancer factor TEF-3.

Protein Sequence: MYGRNELIARYIKLRTGKTRTRKQVSSHIQVLARRKAREIQAKLKDQAAKDKALQSMAAMSSAQIISATAFHSSMALARGPGRPAVSGFWQGALPGQAGTSHDVKPFSQQTYAVQPPLPLPGFESPAGPAPSPSAPPAPPWQGRSVASSKLWMLEFSAFLEQQQDPDTYNKHLFVHIGQSSPSYSDPYLEAVDIRQIYDKFPEKKGGLKDLFERGPSNAFFLVKFWADLNTNIEDEGSSFYGVSSQYESPENMIITCSTKVCSFGKQVVEKVETEYARYENGHYSYRIHRSPLCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYRLVKE.

Protein Size: 74-434 aa.

Purification: Affinity purified using AC.

Purity: Greater than 85% as determined by SDS-PAGE.

Source: E. Coli.

Tag: N-terminal GST-tagged
More Information
SKU AVIOPCA335976-100
Manufacturer Aviva Systems Biology
Manufacturer SKU OPCA335976-100
Green Labware No
Package Unit 100µg
Quantity Unit STK
Reactivity Human
Human Gene ID 7004
Product information (PDF)
×
MSDS (PDF)
×