Tekt3 Antibody - N-terminal region : HRP

Tekt3 Antibody - N-terminal region : HRP
SKU
AVIARP57677_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Tekt3 is a structural component of ciliary and flagellar microtubules. It forms filamentous polymers in the walls of ciliary and flagellar microtubules. It is required for progressive sperm mobility.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Rat

Molecular Weight: 54kDa

Peptide Sequence: Synthetic peptide located within the following region: MLPFVSNRTTLFTRYTPDDWYRSTLVGFQESNCSRHNSERLRVDTSRLIQ

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Tektin-3

Protein Size: 490

Purification: Affinity Purified
More Information
SKU AVIARP57677_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57677_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 287392
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×