TENT5C Antibody - middle region : Biotin

TENT5C Antibody - middle region : Biotin
SKU
AVIARP53723_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FAM46C

Key Reference: Gregory,S.G., (2006) Nature 441 (7091), 315-321

Molecular Weight: 43kDa

Peptide Sequence: Synthetic peptide located within the following region: LIATKNPEEIRGGGLLKYSNLLVRDFRPTDQEEIKTLERYMCSRFFIDFP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: terminal nucleotidyltransferase 5C

Protein Size: 391

Purification: Affinity Purified
More Information
SKU AVIARP53723_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP53723_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 54855
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×