Terf2ip Antibody - middle region : Biotin

Terf2ip Antibody - middle region : Biotin
SKU
AVIARP57301_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: Terf2ip acts both as a regulator of telomere function and as a transcription regulator. It is involved in the regulation of telomere length and protection as a component of the shelterin complex (telosome). In contrast to other components of the shelterin complex, it is dispensible for telomere capping and does not participate in the protection of telomeres against non-homologous end-joining (NHEJ)-mediated repair. Instead, it is required to negatively regulate telomere recombination and is essential for repressing homology-directed repair (HDR), which can affect telomere length.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 31kDa

Peptide Sequence: Synthetic peptide located within the following region: LTYVKENARSPSSVTGNALWKAMEKSSLTQHSWQSLKDRYLKHLRGQEHK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Telomeric repeat-binding factor 2-interacting protein 1

Protein Size: 286

Purification: Affinity Purified
More Information
SKU AVIARP57301_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57301_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 57321
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×