TERF2IP Antibody - middle region : HRP

TERF2IP Antibody - middle region : HRP
SKU
AVIARP57302_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The gene encodes a protein that is part of a complex involved in telomere length regulation. Pseudogenes are present on chromosomes 5 and 22.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TERF2IP

Molecular Weight: 44kDa

Peptide Sequence: Synthetic peptide located within the following region: EDPEAADSGEPQNKRTPDLPEEEYVKEEIQENEEAVKKMLVEATREFEEV

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Telomeric repeat-binding factor 2-interacting protein 1

Protein Size: 399

Purification: Affinity Purified
More Information
SKU AVIARP57302_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57302_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 54386
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×