TEX19 Antibody - middle region : HRP

TEX19 Antibody - middle region : HRP
SKU
AVIARP56004_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: TEX19 is required during spermatogenesis and placenta development, probably by participating to the repression of retrotransposable elements and prevent their mobilization (By similarity). .

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human TEX19

Molecular Weight: 18kDa

Peptide Sequence: Synthetic peptide located within the following region: MEHTEAESEQEGSSGMELSWGQSPGQPVQGGSEAWGPGTLAAAPEGLEDA

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Testis-expressed sequence 19 protein

Protein Size: 164

Purification: Affinity Purified
More Information
SKU AVIARP56004_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56004_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Western Blotting
Human Gene ID 400629
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×