TFDP3 Antibody - middle region : Biotin

TFDP3 Antibody - middle region : Biotin
SKU
AVIARP58171_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The specific function of the protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TFDP3

Molecular Weight: 38kDa

Peptide Sequence: Synthetic peptide located within the following region: ASDLTNIAIGMLATSSGGSQYSGSRVETPAVEEEEEEDNNDDDLSENDED

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Transcription factor Dp family member 3

Protein Size: 345

Purification: Affinity Purified
More Information
SKU AVIARP58171_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58171_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 51270
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×