TFPI2 Antibody - middle region : FITC

TFPI2 Antibody - middle region : FITC
SKU
AVIARP58242_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: TFPI2 may play a role in the regulation of plasmin-mediated matrix remodeling. It inhibits trypsin, plasmin, factor VIIa/tissue factor and weakly factor Xa. TFPI2 has no effect on thrombin.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TFPI2

Key Reference: Becker,J., (2008) Int. J. Oncol. 32 (1), 235-240

Molecular Weight: 26kDa

Peptide Sequence: Synthetic peptide located within the following region: NANNFYTWEACDDACWRIEKVPKVCRLQVSVDDQCEGSTEKYFFNLSSMT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Tissue factor pathway inhibitor 2

Protein Size: 235

Purification: Affinity Purified
More Information
SKU AVIARP58242_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58242_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Western Blotting, Immunohistochemistry
Human Gene ID 7980
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×