Uniprot: P01135
Gene Name: TGFA
Immunogen: Recombinant human TGFA
Purity: ≥85%
Formulation: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.09% sodium azide
Identity-Mouse (%): 92%
Core Sequence: SADPPVAAAVVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLAV
Homologies: Highest antigen sequence identity to the following orthologs: Mouse - 92%, Rat - 92%, Pig - 96%, Cynomolgus monkey - 99%
Alternative gene names: /
Alternative protein names: Protransforming growth factor alpha [Cleaved into: Transforming growth factor alpha; TGF-alpha; EGF-like TGF; ETGF; TGF type 1]
Protein name: Transforming growth factor alpha
Product panel: Cytokines
Clone No.: K94027_2E8
Antigen Species: Human
Target Name: TGFA
IHC Verification: Fail (Kidney)
IHC Dilution: N/A
WB Verification: Fail (Purification of Antigens)
WB Dilution: N/A
IP Verification: -
IP Dilution: N/A
IF Verification: -
IF Dilution: N/A
Sandwich ELISA Verification: succeed
Sandwich ELISA Dilution: 1:250~1:500
Antigen ID: PP-3331
Cross reactivity: Not tested
English
Deutsch
