TH1L Antibody - N-terminal region : FITC

TH1L Antibody - N-terminal region : FITC
SKU
AVIARP57805_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The NELF complex of proteins interacts with the DSIF protein complex to repress transcriptional elongation by RNA polymerase II. The protein encoded by this gene is an essential part of the NELF complex. Alternative translation initiation site usage results in the formation of two isoforms with different N-termini.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TH1L

Molecular Weight: 66kDa

Peptide Sequence: Synthetic peptide located within the following region: GEGEDDAEVQQECLHKFSTRDYIMEPSIFNTLKRYFQAGGSPENVIQLLS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Negative elongation factor C/D

Protein Size: 590

Purification: Affinity Purified
More Information
SKU AVIARP57805_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57805_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 51497
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×