THYN1 Antibody - N-terminal region : Biotin

THYN1 Antibody - N-terminal region : Biotin
SKU
AVIARP54987_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: THYN1 is a protein that is highly conserved among vertebrates and plant species and may be involved in the induction of apoptosis.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human THYN1

Molecular Weight: 26kDa

Peptide Sequence: Synthetic peptide located within the following region: MSRPRKRLAGTSGSDKGLSGKRTKTENSGEALAKVEDSNPQKTSATKNCL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Thymocyte nuclear protein 1

Protein Size: 225

Purification: Affinity Purified
More Information
SKU AVIARP54987_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54987_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Guinea Pig
Clonality Polyclonal
Application Western Blotting
Human Gene ID 29087
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×