TINAGL1 Antibody - middle region : HRP

TINAGL1 Antibody - middle region : HRP
SKU
AVIARP57622_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: TINAGL1 may be implicated in the adrenocortical zonation and in mechanisms for repressing the CYP11B1 gene expression in adrenocortical cells. This is a non catalytic peptidase C1 family protein.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TINAGL1

Molecular Weight: 52kDa

Peptide Sequence: Synthetic peptide located within the following region: ENGPVQALMEVHEDFFLYKGGIYSHTPVSLGRPERYRRHGTHSVKITGWG

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Tubulointerstitial nephritis antigen-like

Protein Size: 467

Purification: Affinity Purified
More Information
SKU AVIARP57622_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57622_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 64129
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×