TKFC Antibody - N-terminal region : Biotin

TKFC Antibody - N-terminal region : Biotin
SKU
AVIARP55278_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: This gene is a member of the family of dihydroxyacetone kinases, which have a protein structure distinct from other kinases. The product of this gene phosphorylates dihydroxyacetone, and also catalyzes the formation of riboflavin 4',5'-phosphate (aka cyclin FMN) from FAD. Several alternatively spliced transcript variants have been found for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human DAK

Key Reference: Diao,F., (2007) Proc. Natl. Acad. Sci. U.S.A. 104 (28), 11706-11711

Molecular Weight: 59kDa

Peptide Sequence: Synthetic peptide located within the following region: MTSKKLVNSVAGCADDALAGLVACNPNLQLLQGHRVALRSDLDSLKGRVA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: triokinase/FMN cyclase

Protein Size: 575

Purification: Affinity Purified
More Information
SKU AVIARP55278_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55278_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting, Immunohistochemistry
Human Gene ID 26007
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×