TMEM146 Antibody - middle region : FITC

TMEM146 Antibody - middle region : FITC
SKU
AVIARP55551_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: TMEM146 is a single-pass type I membrane protein. The functions of TMEM146 remain unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TMEM146

Key Reference: Strausberg,R.L., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903

Molecular Weight: 90kDa

Peptide Sequence: Synthetic peptide located within the following region: NPHSLGFQATFYENGYTSDGNTKYKLDIFLKQQQHWGRTDSNFTSSLKKA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Cation channel sperm-associated protein subunit delta

Protein Size: 798

Purification: Affinity Purified
More Information
SKU AVIARP55551_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55551_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Pig (Porcine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 257062
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×