Calculated MW: 17
Form: Liquid
Buffer (with preservative): 4mg Trehalose, 0.9mg NaCl, 0.2mg Na₂HPO₄, 0.05mg sodium azide.
Concentration: .5 mg/ml (Please refer to the vial label for the specific concentration.)
Uniprot ID: Q9H8M9
Antigen Species: Human
Immunogen: A synthetic peptide corresponding to a sequence of human TMEM166/EVA1A (MRLPLSHSPEHVEMALLSNILAAYSFVSENPERA).
Purification: Purified by affinity chromatography
Conjugation: Unconjugated
Full Name: eva-1 homolog A, regulator of programmed cell death