TMEM166 antibody

TMEM166 antibody
SKU
GTX04091-100
Packaging Unit
100 μg
Manufacturer
GeneTex

Availability: loading...
Price is loading...
Calculated MW: 17

Form: Liquid

Buffer (with preservative): 4mg Trehalose, 0.9mg NaCl, 0.2mg Na₂HPO₄, 0.05mg sodium azide.

Concentration: .5 mg/ml (Please refer to the vial label for the specific concentration.)

Uniprot ID: Q9H8M9

Antigen Species: Human

Immunogen: A synthetic peptide corresponding to a sequence of human TMEM166/EVA1A (MRLPLSHSPEHVEMALLSNILAAYSFVSENPERA).

Purification: Purified by affinity chromatography

Conjugation: Unconjugated

Full Name: eva-1 homolog A, regulator of programmed cell death
More Information
SKU GTX04091-100
Manufacturer GeneTex
Manufacturer SKU GTX04091-100
Package Unit 100 μg
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus)
Clonality Polyclonal
Application Immunofluorescence, Immunohistochemistry (paraffin), Western Blotting, Flow Cytometry, Immunocytochemistry
Isotype IgG
Human Gene ID 84141
Host Rabbit
Conjugate Unconjugated
Product information (PDF) Download
MSDS (PDF)
×