TMEM184A Antibody - C-terminal region : HRP

TMEM184A Antibody - C-terminal region : HRP
SKU
AVIARP54530_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: TMEM184A is a multi-pass membrane proteinPotential. It belongs to the UPF0206 family. The exact function of TMEM184A remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human TMEM184A

Key Reference: Scherer,S.W., (2003) Science 300 (5620), 767-772

Molecular Weight: 46kDa

Peptide Sequence: Synthetic peptide located within the following region: CQVYAEKKENSPAPPAPMQSISSGIRETVSPQDIVQDAIHNFSPAYQHYT

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Transmembrane protein 184A

Protein Size: 413

Purification: Affinity Purified
More Information
SKU AVIARP54530_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54530_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 202915
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×